Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CHRNE (Human) Recombinant Protein (Q01)

  • Catalog # : H00001145-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CHRNE partial ORF ( NP_000071, 21 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001145-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1145
  • Gene Name:
  • CHRNE
  • Gene Alias:
  • ACHRE,CMS1D,CMS1E,CMS2A,FCCMS,SCCMS
  • Gene Description:
  • cholinergic receptor, nicotinic, epsilon
  • Gene Summary:
  • Acetylcholine receptors at mature mammalian neuromuscular junctions are pentameric protein complexes composed of four subunits in the ratio of two alpha subunits to one beta, one epsilon, and one delta subunit. The acetylcholine receptor changes subunit composition shortly after birth when the epsilon subunit replaces the gamma subunit seen in embryonic receptors. Mutations in the epsilon subunit are associated with congenital myasthenic syndrome. [provided by RefSeq
  • Other Designations:
  • AchR epsilon subunit,cholinergic receptor, nicotinic, epsilon polypeptide,nicotinic acetylcholine receptor epsilon polypeptide
  • RSS
  • YouTube
  • Linkedin
  • Facebook