CHRNA7 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CHRNA7 partial ORF (AAH37571, 182 a.a. - 502 a.a.) recombinant protein with GST tag at N-terminal.
Sequence
MQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLSLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMITVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA
Theoretical MW (kDa)
61.05
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CHRNA7
Entrez GeneID
1139GeneBank Accession#
BC037571Protein Accession#
AAH37571Gene Name
CHRNA7
Gene Alias
CHRNA7-2, NACHRA7
Gene Description
cholinergic receptor, nicotinic, alpha 7
Omim ID
118511Gene Ontology
HyperlinkGene Summary
The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits. The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia. An evolutionarily recent partial duplication event in this region results in a hybrid containing sequence from this gene and a novel FAM7A gene. [provided by RefSeq
Other Designations
a7 nicotinic acetylcholine receptor|alpha 7 neuronal nicotinic acetylcholine receptor|alpha-7 nicotinic cholinergic receptor subunit|cholinergic receptor, nicotinic, alpha polypeptide 7|neuronal acetylcholine receptor protein, alpha-7 chain
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
3-dehydroandrographolide protects against lipopolysaccharide-induced inflammation through the cholinergic anti-inflammatory pathway.
Lu Z, Xie P, Zhang D, Sun P, Yang H, Ye J, Cao H, Huo C, Zhou H, Chen Y, Ye W, Yu L, Liu J.
Biochemical Pharmacology 2018 Nov; 158:305.
Application:Func, Compound 3-DA.
-
APS8 Delays Tumor Growth in Mice by Inducing Apoptosis of Lung Adenocarcinoma Cells Expressing High Number of α7 Nicotinic Receptors.
Berne S, Čemažar M, Frangež R, Juntes P, Kranjc S, Grandič M, Savarin M, Turk T.
Marine Drugs 2018 Oct; 16(10):E367.
Application:Func, WB-Re, Human, A-549 cells.
-
Increased antibodies for the alpha 7 subunit of the nicotinic receptor in schizophrenia.
Chandley MJ, Miller MN, Newell Kwasigroch C, Wilson TD, Miller BE.
Schizophrenia Research 2009 Apr; 109(1-3):98.
Application:ELISA, Human, Human serum.
-
3-dehydroandrographolide protects against lipopolysaccharide-induced inflammation through the cholinergic anti-inflammatory pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com