Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CHRNA5 polyclonal antibody (A01)

  • Catalog # : H00001138-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CHRNA5.
  • Immunogen:
  • CHRNA5 (NP_000736, 38 a.a. ~ 131 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001138-A01
    Western Blot detection against Immunogen (36.45 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CHRNA5 polyclonal antibody (A01), Lot # 050914JC01. Western Blot analysis of CHRNA5 expression in Daoy.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1138
  • Gene Name:
  • CHRNA5
  • Gene Alias:
  • LNCR2
  • Gene Description:
  • cholinergic receptor, nicotinic, alpha 5
  • Gene Summary:
  • Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits. See MIM 118508 for additional background information on AChRs.[supplied by OMIM
  • Other Designations:
  • Cholinergic receptor, neuronal nicotinic, alpha polypeptide-5,cholinergic receptor, nicotinic, alpha polypeptide 5,neuronal nicotinic acetylcholine receptor, alpha5 subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook