Product Browser

Last updated: 2017/3/26
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CHRM3 polyclonal antibody (A01)

  • Catalog # : H00001131-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CHRM3.
  • Immunogen:
  • CHRM3 (NP_000731, 1 a.a. ~ 67 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQ
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001131-A01
    Western Blot detection against Immunogen (33.48 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CHRM3 polyclonal antibody (A01), Lot # 051011JC01 Western Blot analysis of CHRM3 expression in PC-12 ( Cat # L012V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1131
  • Gene Name:
  • CHRM3
  • Gene Alias:
  • HM3
  • Gene Description:
  • cholinergic receptor, muscarinic 3
  • Gene Summary:
  • The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 3 controls smooth muscle contraction and its stimulation causes secretion of glandular tissue. [provided by RefSeq
  • Other Designations:
  • m3 muscarinic receptor,muscarinic acetylcholine receptor M3
  • RSS
  • YouTube
  • Linkedin
  • Facebook