CHN1 monoclonal antibody (M03), clone 3A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CHN1 monoclonal antibody (M03), clone 3A3. Western Blot analysis of CHN1 expression in NIH/3T3(Cat # L018V1 ).
Western Blot (Cell lysate)
CHN1 monoclonal antibody (M03), clone 3A3. Western Blot analysis of CHN1 expression in HeLa(Cat # L013V1 ).
Western Blot (Cell lysate)
CHN1 monoclonal antibody (M03), clone 3A3. Western Blot analysis of CHN1 expression in PC-12(Cat # L012V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CHN1 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CHN1.
Immunogen
CHN1 (AAH11393, 91 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QTRNFRLYYDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTINPIYEHVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKENEQIP
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CHN1 monoclonal antibody (M03), clone 3A3. Western Blot analysis of CHN1 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
CHN1 monoclonal antibody (M03), clone 3A3. Western Blot analysis of CHN1 expression in HeLa(Cat # L013V1 ).Western Blot (Cell lysate)
CHN1 monoclonal antibody (M03), clone 3A3. Western Blot analysis of CHN1 expression in PC-12(Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CHN1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — CHN1
Entrez GeneID
1123GeneBank Accession#
BC011393Protein Accession#
AAH11393Gene Name
CHN1
Gene Alias
ARHGAP2, CHN, DURS2, RHOGAP2
Gene Description
chimerin (chimaerin) 1
Omim ID
118423Gene Ontology
HyperlinkGene Summary
This gene encodes GTPase-activating protein for p21-rac and a phorbol ester receptor. It plays an important role in ocular motor axon pathfinding. Heterozygous missense mutations in this gene cause Duane's retraction syndrome 2 (DURS2). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
A-chimaerin|Chimerin 1 (GTPase-activating protein, rho, 2)|Rho GTPase-activating protein 2|a2-chimaerin|alpha-chimerin|n-chimerin
-
Interactome
-
Disease
-
Publication Reference
-
Tsc2-Rheb signaling regulates EphA-mediated axon guidance.
Nie D, Di Nardo A, Han JM, Baharanyi H, Kramvis I, Huynh T, Dabora S, Codeluppi S, Pandolfi PP, Pasquale EB, Sahin M.
Nature Neuroscience 2010 Feb; 13(2):163.
Application：WB, Mouse, Cortical neurons.
-
Tsc2-Rheb signaling regulates EphA-mediated axon guidance.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com