CHD4 monoclonal antibody (M01), clone 4H4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CHD4 monoclonal antibody (M01), clone 4H4 Western Blot analysis of CHD4 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of CHD4 expression in transfected 293T cell line by CHD4 monoclonal antibody (M01), clone 4H4.
Lane 1: CHD4 transfected lysate(220 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CHD4 on formalin-fixed paraffin-embedded human transitional cell carcinoma. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CHD4 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CHD4.
Immunogen
CHD4 (NP_001264, 1632 a.a. ~ 1730 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (91)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CHD4 monoclonal antibody (M01), clone 4H4 Western Blot analysis of CHD4 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of CHD4 expression in transfected 293T cell line by CHD4 monoclonal antibody (M01), clone 4H4.
Lane 1: CHD4 transfected lysate(220 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CHD4 on formalin-fixed paraffin-embedded human transitional cell carcinoma. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CHD4 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — CHD4
Entrez GeneID
1108GeneBank Accession#
NM_001273Protein Accession#
NP_001264Gene Name
CHD4
Gene Alias
DKFZp686E06161, Mi-2b, Mi2-BETA
Gene Description
chromodomain helicase DNA binding protein 4
Omim ID
603277Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis develop antibodies against this protein. [provided by RefSeq
Other Designations
Mi-2 autoantigen 218 kDa protein
-
Interactome
-
Publication Reference
-
Physical and functional interactions between the histone H3K4 demethylase KDM5A and the nucleosome remodeling and deacetylase (NuRD) complex.
Nishibuchi G, Shibata Y, Hayakawa T, Hayakawa N, Ohtani Y, Sinmyozu K, Tagami H, Nakayama J.
The Journal of Biological Chemistry 2014 Oct; 289(42):28956.
Application：WB-Ce, Human, HeLa cells.
-
Physical and functional interactions between the histone H3K4 demethylase KDM5A and the nucleosome remodeling and deacetylase (NuRD) complex.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com