Product Browser

Last updated: 2017/2/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CGA polyclonal antibody (A02)

  • Catalog # : H00001081-A02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CGA.
  • Immunogen:
  • CGA (AAH10957, 25 a.a. ~ 116 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • APDVQDCPECTLQENPLFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001081-A02
    Western Blot detection against Immunogen (36.23 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1081
  • Gene Name:
  • CGA
  • Gene Alias:
  • CG-ALPHA,FSHA,GPHA1,GPHa,HCG,LHA,TSHA
  • Gene Description:
  • glycoprotein hormones, alpha polypeptide
  • Gene Summary:
  • The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000016825,chorionic gonadotropin, alpha polypeptide,follicle-stimulating hormone alpha subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook