CFL1 monoclonal antibody (M04J), clone 1A1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CFL1 monoclonal antibody (M04J), clone 1A1. Western Blot analysis of CFL1 expression in HeLa.
Western Blot (Cell lysate)
CFL1 monoclonal antibody (M04J), clone 1A1. Western Blot analysis of CFL1 expression in NIH/3T3.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CFL1 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CFL1 is 3 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to CFL1 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (44 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant CFL1.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
CFL1 (AAH11005.1, 1 a.a. ~ 166 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFAKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEGVKDRCTLAEKLGGSAVISLEGKPL
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (44 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CFL1 monoclonal antibody (M04J), clone 1A1. Western Blot analysis of CFL1 expression in HeLa.Western Blot (Cell lysate)
CFL1 monoclonal antibody (M04J), clone 1A1. Western Blot analysis of CFL1 expression in NIH/3T3.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CFL1 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CFL1 is 3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CFL1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — CFL1
Entrez GeneID
1072GeneBank Accession#
BC011005.1Protein Accession#
AAH11005.1Gene Name
CFL1
Gene Alias
CFL
Gene Description
cofilin 1 (non-muscle)
Omim ID
601442Gene Ontology
HyperlinkGene Summary
Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.[supplied by OMIM
Other Designations
-
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com