CETN3 monoclonal antibody (M01), clone 3E6(H00001070-M01)

CETN3 monoclonal antibody (M01), clone 3E6

Catalog # H00001070-M01

* Location

Size

Price

Stock

Quantity

Size:50 ug

Price: USD $ 335.00

Stock：

order now, ship next day

* The price is valid only in USA. Please select country.

Hello Spring Sale - Blossom with Savings!

Contact Info

+1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098
+1-909-992-3401
sales@abnova.com

Product Inquiry

Bulk Inquiry

Service Inquiry

Add to Interest Products

Compare (Max 4)

Datasheet
MSDS
More Files
- Datasheet
- MSDS
Print / PDF
Write a Review
More Functions
- Print / PDF
- Write a Review

Images

Application

Western Blot (Cell lysate)

CETN3 monoclonal antibody (M01), clone 3E6 Western Blot analysis of CETN3 expression in Jurkat ( Cat # L017V1 ).

Protocol Download

Application

Western Blot (Transfected lysate)

Western Blot analysis of CETN3 expression in transfected 293T cell line by CETN3 monoclonal antibody (M01), clone 3E6.

Lane 1: CETN3 transfected lysate(19.5 KDa).
Lane 2: Non-transfected lysate.

Protocol Download

Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged CETN3 is approximately 0.1ng/ml as a capture antibody.

Protocol Download

Application

RNAi Knockdown (Antibody validated)

Western blot analysis of CETN3 over-expressed 293 cell line, cotransfected with CETN3 Validated Chimera RNAi ( Cat # H00001070-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CETN3 monoclonal antibody (M01), clone 3E6 (Cat # H00001070-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Protocol Download

QC Test

Western Blot detection against Immunogen (36.63 KDa) .

Specification

Product Description

Mouse monoclonal antibody raised against a partial recombinant CETN3.

Immunogen

CETN3 (AAH05383, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence

MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPH

Host

Mouse

Reactivity

Human

Isotype

IgG2b Kappa

Quality Control Testing

Antibody Reactive Against Recombinant Protein.

Western Blot detection against Immunogen (36.63 KDa) .

Storage Buffer

In 1x PBS, pH 7.4

Storage Instruction

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Applications

Western Blot (Cell lysate)
CETN3 monoclonal antibody (M01), clone 3E6 Western Blot analysis of CETN3 expression in Jurkat ( Cat # L017V1 ).
Protocol Download

Western Blot (Transfected lysate)
Western Blot analysis of CETN3 expression in transfected 293T cell line by CETN3 monoclonal antibody (M01), clone 3E6.

Lane 1: CETN3 transfected lysate(19.5 KDa).
Lane 2: Non-transfected lysate.

Protocol Download

Western Blot (Recombinant protein)

Protocol Download

Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CETN3 is approximately 0.1ng/ml as a capture antibody.
Protocol Download

ELISA

RNAi Knockdown (Antibody validated)
Western blot analysis of CETN3 over-expressed 293 cell line, cotransfected with CETN3 Validated Chimera RNAi ( Cat # H00001070-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CETN3 monoclonal antibody (M01), clone 3E6 (Cat # H00001070-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Protocol Download
Gene Info — CETN3

Entrez GeneID
1070

GeneBank Accession#
BC005383

Protein Accession#
AAH05383

Gene Name

CETN3

Gene Alias

CEN3, MGC12502, MGC138245

Gene Description

centrin, EF-hand protein, 3 (CDC31 homolog, yeast)

Omim ID
602907

Gene Ontology
Hyperlink

Gene Summary

The protein encoded by this gene contains four EF-hand calcium binding domains, and is a member of the centrin protein family. Centrins are evolutionarily conserved proteins similar to the CDC31 protein of S. cerevisiae. Yeast CDC31 is located at the centrosome of interphase and mitotic cells, where it plays a fundamental role in centrosome duplication and separation. Multiple forms of the proteins similar to the yeast centrin have been identified in human and other mammalian cells, some of which have been shown to be associated with centrosome fractions. This protein appears to be one of the most abundant centrins associated with centrosome, which suggests a similar function to its yeast counterpart. [provided by RefSeq

Other Designations

CDC31 yeast homolog|EF-hand superfamily member|centrin 3
Interactome
- CETN3
Publication Reference
- Small-molecule inhibition of kinesin KIF18A reveals a mitotic vulnerability enriched in chromosomally unstable cancers.
  Marc Payton, Brian Belmontes, Kelly Hanestad, Jodi Moriguchi, Kui Chen, John D. McCarter, Grace Chung, Maria Stefania Ninniri, Jan Sun, Raffi Manoukian, Stuart Chambers, Seok-Man Ho, Robert J. M. Kurzeja, Katheryne Z. Edson, Upendra P. Dahal, Tian Wu, Sharon Wannberg, Pedro J. Beltran, Jude Canon, Andrew S. Boghossian, Matthew G. Rees, Melissa M. Ronan, Jennifer A. Roth, Sheroy Minocherhomji, Matthew P. Bourbeau, Jennifer R. Allen, Angela Coxon, Nuria A. Tamayo & Paul E. Hughes.
  
  Nature Cancer 2024 Jan; 5(1):66.
  
  Application：Cell Staining, Human, Hela, CAL-51, MDA-MB-157 cells.
- Proteomic profiling of centrosomes across multiple mammalian cell and tissue types by an affinity capture method.
  Sarah Carden, Elisa Vitiello, Ivan Rosa E Silva, James Holder, Valentina Quarantotti, Kamal Kishore, Valar Nila Roamio Franklin, Clive D'Santos, Takashi Ochi, Mark van Breugel, Fanni Gergely.
  
  Developmental Cell 2023 Nov; 58(21):2393.
  
  Application：WB, IF, EM, Human, 293T cells.
- Microglia reactivity entails microtubule remodeling from acentrosomal to centrosomal arrays.
  Maria Rosito, Caterina Sanchini, Giorgio Gosti, Manuela Moreno, Simone De Panfilis, Maria Giubettini, Doriana Debellis, Federico Catalano, Giovanna Peruzzi, Roberto Marotta, Alessia Indrieri, Elvira De Leonibus, Maria Egle De Stefano, Davide Ragozzino, Giancarlo Ruocco, Silvia Di Angelantonio, Francesca Bartolini.
  
  Cell Reports 2023 Feb; 42(2):112104.
  
  Application：IF, Mouse, Primary microglia.
- Characterization of Primary Cilia Formation in Human ESC-Derived Retinal Organoids.
  Ke Ning, Ziming Luo, Tia J Kowal, Matthew Tran, Rishab Majumder, Trent M Jarin, Albert Y Wu, Jeffrey L Goldberg, Yang Sun.
  
  Stem Cells International 2023 Jan; 2023:6494486.
  
  Application：IF, Human, Human retina.
- Human SFI1 and Centrin form a complex critical for centriole architecture and ciliogenesis.
  Marine H Laporte, Imène B Bouhlel, Eloïse Bertiaux, Ciaran G Morrison, Alexia Giroud, Susanne Borgers, Juliette Azimzadeh, Michel Bornens, Paul Guichard, Anne Paoletti, Virginie Hamel.
  
  The EMBO Journal 2022 Sep; e112107.
  
  Application：IF, Human, RPE-1 cells.
- Prominin 1 and Notch regulate ciliary length and dynamics in multiciliated cells of the airway epithelium.
  Carlos F H Serra, Helu Liu, Jun Qian, Munemasa Mori, Jining Lu, Wellington V Cardoso.
  
  iScience 2022 Aug; 25(8):104751.
  
  Application：IF, Mouse, Mouse tracheal epithelial cells .
- Acute inhibition of centriolar satellite function and positioning reveals their functions at the primary cilium.
  Özge Z Aydin, Sevket Onur Taflan, Can Gurkaslar, Elif Nur Firat-Karalar.
  
  PLoS Biology 2020 Jun; 18(6):e3000679.
  
  Application：IF, Human, HeLa cells.
- CCDC57 Cooperates with Microtubules and Microcephaly Protein CEP63 and Regulates Centriole Duplication and Mitotic Progression.
  H Kubra Gurkaslar, Efraim Culfa, Melis D Arslanhan, Mariana Lince-Faria, Elif Nur Firat-Karalar.
  
  Cell Reports 2020 May; 31(6):107630.
  
  Application：IF, Human, U2OS cells.
- CCDC61/VFL3 Is a Paralog of SAS6 and Promotes Ciliary Functions.
  Takashi Ochi, Valentina Quarantotti, Huawen Lin, Jerome Jullien, Ivan Rosa E Silva, Francesco Boselli, Deepak D Barnabas, Christopher M Johnson, Stephen H McLaughlin, Stefan M V Freund, Andrew N Blackford, Yuu Kimata, Raymond E Goldstein, Stephen P Jackson, Tom L Blundell, Susan K Dutcher, Fanni Gergely, Mark van Breugel.
  
  Structure 2020 Jun; 28(6):674.
  
  Application：IF, Human, RPE-1 cells.
- CCDC84 Acetylation Oscillation Regulates Centrosome Duplication by Modulating HsSAS-6 Degradation.
  Wang T, Zou Y, Huang N, Teng J, Chen J.
  
  Cell Reports 2019 Nov; 29(7):2078.
  
  Application：IF, Human, HeLa cells.
- Immunofluorescence-based Determination of Centrosome Number in Tissue Samples.
  Mengdie Wang, Gregory C Rogers, Anne E Cress.
  
  Bio-Protocol 2019 Oct; 9(20):e3396.
  
  Application：IF, IHC-P, Human, Human cancer tissue, Human normal tissue.
- Centrosome loss results in an unstable genome and malignant prostate tumors.
  Wang M, Nagle RB, Knudsen BS, Cress AE, Rogers GC.
  
  Oncogene 2019 Sep; [Epub].
  
  Application：IF, Human, IPEC37, LNCaP, PEC, PrEC, RWPE1, VCap cells .
- Primary Cilia Mediate Diverse Kinase Inhibitor Resistance Mechanisms in Cancer.
  Jenks AD, Vyse S, Wong JP, Kostaras E, Keller D, Burgoyne T, Shoemark A, Tsalikis A, de la Roche M, Michaelis M, Cinatl J Jr, Huang PH, Tanos BE.
  
  Cell Reports 2018 Jun; 23(10):3042.
  
  Application：IF, Human, A204, A-549, HCC4006 cells.
- Coupling bimolecular PARylation biosensors with genetic screens to identify PARylation targets.
  Krastev DB, Pettitt SJ, Campbell J, Song F, Tanos BE, Stoynov SS, Ashworth A, Lord CJ.
  
  Nature Communications 2018 May; 9(1):2016.
  
  Application：IF, Human, HeLa cells.
- Centrobin controls primary ciliogenesis in vertebrates.
  Ogungbenro YA, Tena TC, Gaboriau D, Lalor P, Dockery P, Philipp M, Morrison CG.
  
  The Journal of Cell Biology 2018 Apr; 217(4):1205.
  
  Application：IF, Human, hTERT-RPE1 cells.
- Excess of a Rassf1-targeting microRNA, miR-193a-3p, perturbs cell division fidelity.
  Pruikkonen S, Kallio MJ.
  
  Amino Acids 2017 Apr; 116(11):1451.
  
  Application：IF, Human, HeLa cells.
- Severe NDE1-mediated microcephaly results from neural progenitor cell cycle arrests at multiple specific stages.
  Doobin DJ, Kemal S, Dantas TJ, Vallee RB.
  
  Nature Communications 2016 Aug; 7:12551.
  
  Application：IF, Rat, radial glia progenitor (RGP) cell.
- Reduced levels of Dusp3/Vhr phosphatase impair normal spindle bipolarity in an Erk1/2 activity dependent manner.
  Tambe MB,Narvi E,Kallio M.
  
  FEBS Letters 2016 Aug; 590(16):2757.
  
  Application：IF, Human, HeLa cells.
- Opposing effects of pericentrin and microcephalin on the pericentriolar material regulate CHK1 activation in the DNA damage response.
  Antonczak AK, Mullee LI, Wang Y, Comartin D, Inoue T, Pelletier L, Morrison CG.
  
  Oncogene 2016 Apr; 35(15):2003.
  
  Application：IF, Chicken, DT40 cells.
- CENP-W Plays a Role in Maintaining Bipolar Spindle Structure.
  Kaczmarczyk A, Sullivan KF.
  
  PLoS One 2014 Oct; 9(10):e106464.
  
  Application：IF, Human, HeLa cells.
- Centmitor-1, a novel acridinyl-acetohydrazide, possesses similar molecular interaction field and antimitotic cellular phenotype as rigosertib, on 01910.na.
  Maki-Jouppila JH, Laine LJ, Rehnberg J, Narvi E, Tiikkainen P, Hukasova E, Halonen P, Lindqvist A, Kallio L, Poso A, Kallio MJ.
  
  Molecular Cancer Therapeutics 2014 May; 13(5):1054.
  
  Application：IF, Human, HeLa cells.
- Loss of centrioles causes chromosomal instability in vertebrate somatic cells.
  Sir JH, Putz M, Daly O, Morrison CG, Dunning M, Kilmartin JV, Gergely F.
  
  The Journal of Cell Biology 2013 Dec; 203(5):747.
  
  Application：IS, Chicken, DT40 cells.
- Abnormal centrosomal structure and duplication in Cep135-deficient vertebrate cells.
  Inanc B, Puetz M, Lalor P, Dockery P, Kuriyama R, Gergely F, Morrison CG.
  
  Molecular Biology of the Cell 2013 Sep; 24(17):2645.
  
  Application：IF, Chicken, DT40 cells.
- Calcium-Binding Capacity of Centrin2 Is Required for Linear POC5 Assembly but Not for Nucleotide Excision Repair.
  Dantas TJ, Daly OM, Conroy PC, Tomas M, Wang Y, Lalor P, Dockery P, Ferrando-May E, Morrison CG.
  
  PLoS One 2013 Jul; 8(7):e68487.
  
  Application：IF, Human, DT40, U2OS cells.
- FAM190A Deficiency Creates a Cell Division Defect.
  Patel K, Scrimieri F, Ghosh S, Zhong J, Kim MS, Ren YR, Morgan RA, Iacobuzio-Donahue CA, Pandey A, Kern SE.
  
  The American Journal of Pathology 2013 Jul; 183(1):296.
  
  Application：IF, Human, HeLa cells.
- The Rilp-like proteins Rilpl1 and Rilpl2 regulate ciliary membrane content.
  Schaub JR, Stearns T.
  
  Molecular Biology of the Cell 2013 Feb; 24(4):453.
  
  Application：IF, Mouse, NIH/3T3, IMCD3 cells.
- Disruption of mouse cenpj, a regulator of centriole biogenesis, phenocopies seckel syndrome.
  McIntyre RE, Lakshminarasimhan Chavali P, Ismail O, Carragher DM, Sanchez-Andrade G, Forment JV, Fu B, Del Castillo Velasco-Herrera M, Edwards A, van der Weyden L, Yang F; Sanger Mouse Genetics Project, Ramirez-Solis R, Estabel J, Gallagher FA, Logan DW, Arends MJ, Tsang SH, Mahajan VB, Scudamore CL, White JK, Jackson SP, Gergely F, Adams DJ.
  
  PLoS Genetics 2012 Nov; 8(11):e1003022.
  
  Application：IF, Mouse, MEFs, Mouse embryonic fibroblasts.
- C-NAP1 and rootletin restrain DNA damage-induced centriole splitting and facilitate ciliogenesis.
  Conroy PC, Saladino C, Dantas TJ, Lalor P, Dockery P, Morrison CG.
  
  Cell Cycle 2012 Oct; 11(20):3769.
  
  Application：IF, Human, hTERT-RPE1 cells.
- DNA damage-induced centrosome amplification occurs via excessive formation of centriolar satellites.
  Löffler H, Fechter A, Liu FY, Poppelreuther S, Krämer A.
  
  Oncogene 2013 Jun; 32(24):2963.
  
  Application：EM, IF, Human, A-549, U2OS cells.
- A primary microcephaly protein complex forms a ring around parental centrioles.
  Sir JH, Barr AR, Nicholas AK, Carvalho OP, Khurshid M, Sossick A, Reichelt S, D'Santos C, Woods CG, Gergely F.
  
  Nature Genetics 2011 Oct; 43(11):1147.
  
  Application：IF, Human, Human lymphocytes.
- Defective nucleotide excision repair with normal centrosome structures and functions in the absence of all vertebrate centrins.
  Dantas TJ, Wang Y, Lalor P, Dockery P, Morrison CG.
  
  International Journal of Cell Biology 2011 Apr; 193(2):307.
  
  Application：IF, WB, Chicken, DT40 cells.
- TPCK targets elements of mitotic spindle and induces cell cycle arrest in prometaphase.
  Fabian Z, Fearnhead HO.
  
  Biochemical and Biophysical Research Communications 2010 May; 395(4):458.
  
  Application：IF, Human, MCF-7 cells.
- CDK5RAP2 functions in centrosome to spindle pole attachment and DNA damage response.
  Barr AR, Kilmartin JV, Gergely F.
  
  The Journal of Cell Biology 2010 Apr; 189(1):23.
  
  Application：IF, Chicken, DT40 cells.

Contact Info

+1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098
+1-909-992-3401
sales@abnova.com

Product Inquiry

Bulk Inquiry

Service Inquiry

Products