CETN3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CETN3 expression in transfected 293T cell line (H00001070-T02) by CETN3 MaxPab polyclonal antibody.
Lane 1: CETN3 transfected lysate(19.50 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to CETN3 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CETN3 protein.
Immunogen
CETN3 (NP_004356.2, 1 a.a. ~ 167 a.a) full-length human protein.
Sequence
MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CETN3 expression in transfected 293T cell line (H00001070-T02) by CETN3 MaxPab polyclonal antibody.
Lane 1: CETN3 transfected lysate(19.50 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to CETN3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CETN3
Entrez GeneID
1070GeneBank Accession#
NM_004365Protein Accession#
NP_004356.2Gene Name
CETN3
Gene Alias
CEN3, MGC12502, MGC138245
Gene Description
centrin, EF-hand protein, 3 (CDC31 homolog, yeast)
Omim ID
602907Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains four EF-hand calcium binding domains, and is a member of the centrin protein family. Centrins are evolutionarily conserved proteins similar to the CDC31 protein of S. cerevisiae. Yeast CDC31 is located at the centrosome of interphase and mitotic cells, where it plays a fundamental role in centrosome duplication and separation. Multiple forms of the proteins similar to the yeast centrin have been identified in human and other mammalian cells, some of which have been shown to be associated with centrosome fractions. This protein appears to be one of the most abundant centrins associated with centrosome, which suggests a similar function to its yeast counterpart. [provided by RefSeq
Other Designations
CDC31 yeast homolog|EF-hand superfamily member|centrin 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com