CETN1 monoclonal antibody (M01), clone 2A6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CETN1 expression in transfected 293T cell line by CETN1 monoclonal antibody (M01), clone 2A6.
Lane 1: CETN1 transfected lysate(19.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CETN1 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CETN1.
Immunogen
CETN1 (AAH29515, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEK
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CETN1 expression in transfected 293T cell line by CETN1 monoclonal antibody (M01), clone 2A6.
Lane 1: CETN1 transfected lysate(19.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CETN1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — CETN1
Entrez GeneID
1068GeneBank Accession#
BC029515Protein Accession#
AAH29515Gene Name
CETN1
Gene Alias
CEN1, CETN
Gene Description
centrin, EF-hand protein, 1
Omim ID
603187Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This encoded protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. [provided by RefSeq
Other Designations
Centrin-1|EF-hand protein|calcium binding protein|centrin 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com