Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CETN1 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00001068-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CETN1 protein.
  • Immunogen:
  • CETN1 (NP_004057, 1 a.a. ~ 172 a.a) full-length human protein.
  • Sequence:
  • MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CETN1 expression in transfected 293T cell line (H00001068-T01) by CETN1 MaxPab polyclonal antibody.

    Lane 1: CETN1 transfected lysate(18.92 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1068
  • Gene Name:
  • CETN1
  • Gene Alias:
  • CEN1,CETN
  • Gene Description:
  • centrin, EF-hand protein, 1
  • Gene Summary:
  • The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This encoded protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. [provided by RefSeq
  • Other Designations:
  • Centrin-1,EF-hand protein,calcium binding protein,centrin 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook