Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CEL (Human) Recombinant Protein (Q01)

  • Catalog # : H00001056-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CEL partial ORF ( AAH42510, 378 a.a. - 477 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIALAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001056-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1056
  • Gene Name:
  • CEL
  • Gene Alias:
  • BAL,BSDL,BSSL,CELL,CEase,FAP,FAPP,LIPA,MODY8
  • Gene Description:
  • carboxyl ester lipase (bile salt-stimulated lipase)
  • Gene Summary:
  • The protein encoded by this gene is a glycoprotein secreted from the pancreas into the digestive tract and from the lactating mammary gland into human milk. The physiological role of this protein is in cholesterol and lipid-soluble vitamin ester hydrolysis and absorption. This encoded protein promotes large chylomicron production in the intestine. Also its presence in plasma suggests its interactions with cholesterol and oxidized lipoproteins to modulate the progression of atherosclerosis. In pancreatic tumoral cells, this encoded protein is thought to be sequestrated within the Golgi compartment and is probably not secreted. This gene contains a variable number of tandem repeat (VNTR) polymorphism in the coding region that may influence the function of the encoded protein. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022450,bile salt-dependent lipase, oncofetal isoform,bile salt-stimulated carboxyl ester lipase,bile salt-stimulated lipase,bile-salt-activated lipase,carboxyl ester hydrolase,carboxyl ester lipase,cholesterol esterase,fetoacinar pancreatic pr
  • RSS
  • YouTube
  • Linkedin
  • Facebook