CEBPG monoclonal antibody (M03), clone S2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CEBPG expression in transfected 293T cell line by CEBPG monoclonal antibody (M03), clone S2.
Lane 1: CEBPG transfected lysate(16.4 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of CEBPG transfected lysate using anti-CEBPG monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CEBPG MaxPab rabbit polyclonal antibody.
Western Blot detection against Immunogen (42.24 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant CEBPG.
Immunogen
CEBPG (AAH13128, 1 a.a. ~ 150 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (93)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (42.24 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CEBPG expression in transfected 293T cell line by CEBPG monoclonal antibody (M03), clone S2.
Lane 1: CEBPG transfected lysate(16.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of CEBPG transfected lysate using anti-CEBPG monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CEBPG MaxPab rabbit polyclonal antibody.ELISA
-
Gene Info — CEBPG
Entrez GeneID
1054GeneBank Accession#
BC013128Protein Accession#
AAH13128Gene Name
CEBPG
Gene Alias
GPE1BP, IG/EBP-1
Gene Description
CCAAT/enhancer binding protein (C/EBP), gamma
Omim ID
138972Gene Ontology
HyperlinkGene Summary
The C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein: a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. The C/EBP family consist of several related proteins, C/EBP alpha, C/EBP beta, C/EBP gamma, and C/EBP delta, that form homodimers and that form heterodimers with each other. CCAAT/enhancer binding protein gamma may cooperate with Fos to bind PRE-I enhancer elements. [provided by RefSeq
Other Designations
CCAAT/enhancer binding protein gamma
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com