CEBPE monoclonal antibody (M01), clone 7A4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CEBPE expression in transfected 293T cell line by CEBPE monoclonal antibody (M01), clone 7A4.
Lane 1: CEBPE transfected lysate(30.6 KDa).
Lane 2: Non-transfected lysate.
RNAi Knockdown (Antibody validated)
Western blot analysis of CEBPE over-expressed 293 cell line, cotransfected with CEBPE Validated Chimera RNAi ( Cat # H00001053-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CEBPE monoclonal antibody (M01), clone 7A4 (Cat # H00001053-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (56.65 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CEBPE.
Immunogen
CEBPE (AAH35797.2, 1 a.a. ~ 281 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (56.65 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CEBPE expression in transfected 293T cell line by CEBPE monoclonal antibody (M01), clone 7A4.
Lane 1: CEBPE transfected lysate(30.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of CEBPE over-expressed 293 cell line, cotransfected with CEBPE Validated Chimera RNAi ( Cat # H00001053-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CEBPE monoclonal antibody (M01), clone 7A4 (Cat # H00001053-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — CEBPE
Entrez GeneID
1053GeneBank Accession#
BC035797Protein Accession#
AAH35797.2Gene Name
CEBPE
Gene Alias
C/EBP-epsilon, CRP1
Gene Description
CCAAT/enhancer binding protein (C/EBP), epsilon
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-delta. The encoded protein may be essential for terminal differentiation and functional maturation of committed granulocyte progenitor cells. Mutations in this gene have been associated with Specific Granule Deficiency, a rare congenital disorder. Multiple variants of this gene have been described, but the full-length nature of only one has been determined. [provided by RefSeq
Other Designations
CCAAT/enhancer binding protein epsilon
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com