CDX4 monoclonal antibody (M06), clone 3F3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CDX4 monoclonal antibody (M06), clone 3F3 Western Blot analysis of CDX4 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
CDX4 monoclonal antibody (M06), clone 3F3. Western Blot analysis of CDX4 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
CDX4 monoclonal antibody (M06), clone 3F3. Western Blot analysis of CDX4 expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot (Cell lysate)
CDX4 monoclonal antibody (M06), clone 3F3. Western Blot analysis of CDX4 expression in NIH/3T3 ( Cat # L018V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDX4 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDX4.
Immunogen
CDX4 (NP_005184.1, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKT
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CDX4 monoclonal antibody (M06), clone 3F3 Western Blot analysis of CDX4 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
CDX4 monoclonal antibody (M06), clone 3F3. Western Blot analysis of CDX4 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
CDX4 monoclonal antibody (M06), clone 3F3. Western Blot analysis of CDX4 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
CDX4 monoclonal antibody (M06), clone 3F3. Western Blot analysis of CDX4 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDX4 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — CDX4
Entrez GeneID
1046GeneBank Accession#
NM_005193.1Protein Accession#
NP_005184.1Gene Name
CDX4
Gene Alias
-
Gene Description
caudal type homeobox 4
Omim ID
300025Gene Ontology
HyperlinkOther Designations
OTTHUMP00000023566|caudal type homeo box transcription factor 4|caudal type homeobox transcription factor 4
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com