CDSN monoclonal antibody (M01), clone 6F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDSN.
Immunogen
CDSN (NP_001255, 306 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNP
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.24 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDSN is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — CDSN
Entrez GeneID
1041GeneBank Accession#
NM_001264Protein Accession#
NP_001255Gene Name
CDSN
Gene Alias
D6S586E, HTSS, S
Gene Description
corneodesmosin
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein found in corneodesmosomes, which localize to human epidermis and other cornified squamous epithelia. During maturation of the cornified layers, the protein undergoes a series of cleavages, which are thought to be required for desquamation. The gene is located in the major histocompatibility complex (MHC) class I region on chromosome 6. [provided by RefSeq
Other Designations
OTTHUMP00000029207|differentiated keratinocyte S protein
-
Interactomes
-
Diseases
-
Publication Reference
-
Phenotypic suppression of acral peeling skin syndrome in a patient with autosomal recessive congenital ichthyosis.
Janan Mohamad, Arti Nanda, Mor Pavlovsky, Alon Peled, Natalia Malchin, Kiril Malovitski, Rashida Pramanik, Daphna Weissglas-Volkov, Noam Shomron, John McGrath, Eli Sprecher, Ofer Sarig.
Experimental Dermatology 2020 Aug; 29(8):742.
Application:WB-Tr, Human, Human keratinocytes.
-
Loss-of-function variants in SERPINA12 underlie autosomal recessive palmoplantar keratoderma.
Janan Mohamad, Ofer Sarig, Liron Malki, Tom Rabinowitz, Sari Assaf, Kiril Malovitski, Eden Shkury, Talia Mayer, Dan Vodo, Alon Peled, Daniel Daniely, Mor Pavlovsky, Noam Shomron, Liat Samuelov, Eli Sprecher.
The Journal of Investigative Dermatology 2020 Apr; S0022.
Application:WB-Tr, Human, HaCaT cells.
-
Treatment of hereditary hypotrichosis simplex of the scalp with topical gentamicin.
A Peled, L Samuelov, O Sarig, R Bochner, L Malki, M Pavlovsky, E Pichinuk, M Weil, E Sprecher.
The British Journal of Dermatology 2020 Jul; 183(1):114.
Application:WB-Ce, Human, Human keratinocytes.
-
Cell surface glycans in the human stratum corneum: distribution and depth -related changes.
Abdayem R, Formanek F, Minondo AM, Potter A, Haftek M.
Experimental Dermatology 2016 Nov; 25(11):865.
Application:IEM, IF, Human, Human stratum corneum, Human vertical ultrathin sections of corneocytes.
-
Filaggrin breakdown products determine corneocyte conformation in patients with atopic dermatitis.
Riethmuller C, McAleer MA, Koppes SA, Abdayem R, Franz J, Haftek M, Campbell LE, MacCallum SF, McLean WHI, Irvine AD, Kezic S.
The Journal of Allergy and Clinical Immunology 2015 Dec; 136(6):1573.
Application:IEM, Human, Corneocytes from 3 patients with different FLG mutation genotypes.
-
Development and organization of human stratum corneum after birth: electron microscopy isotropy score and immunocytochemical corneocyte labelling as epidermal maturation's markers in infancy.
Fluhr JW, Lachmann N, Baudouin C, Msika P, Darlenski R, De Belilovsky C, Bossert J, Colomb E, Burdin B, Haftek M.
The British Journal of Dermatology 2014 Nov; 171(5):978.
Application:IEM, Human, Corneocytes.
-
Phenotypic suppression of acral peeling skin syndrome in a patient with autosomal recessive congenital ichthyosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com