CDR2 monoclonal antibody (M01), clone 4F5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CDR2 monoclonal antibody (M01), clone 4F5 Western Blot analysis of CDR2 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
CDR2 monoclonal antibody (M01), clone 4F5. Western Blot analysis of CDR2 expression in K-562 ( Cat # L009V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDR2 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to CDR2 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.73 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDR2.
Immunogen
CDR2 (NP_001793, 296 a.a. ~ 404 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWE
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CDR2 monoclonal antibody (M01), clone 4F5 Western Blot analysis of CDR2 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
CDR2 monoclonal antibody (M01), clone 4F5. Western Blot analysis of CDR2 expression in K-562 ( Cat # L009V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDR2 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CDR2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CDR2
Entrez GeneID
1039GeneBank Accession#
NM_001802Protein Accession#
NP_001793Gene Name
CDR2
Gene Alias
CDR62, Yo
Gene Description
cerebellar degeneration-related protein 2, 62kDa
Omim ID
117340Gene Ontology
HyperlinkGene Summary
O
Other Designations
Yo paraneoplastic antigen|cerebellar degeneration-related antigen-2 (62kD)|cerebellar degeneration-related protein (62kD)|cerebellar degeneration-related protein 2|major Yo paraneoplastic antigen|paraneoplastic cerebellar degeneration-associated antigen
-
Interactome
-
Disease
-
Publication Reference
-
The Onconeural Antigen cdr2 Is a Novel APC/C Target that Acts in Mitosis to Regulate C-Myc Target Genes in Mammalian Tumor Cells.
O'Donovan KJ, Diedler J, Couture GC, Fak JJ, Darnell RB.
PLoS One 2010 Apr; 5(4):e10045.
Application：IF, WB-Tr, Human, HEK 293, HeLa cells.
-
The Onconeural Antigen cdr2 Is a Novel APC/C Target that Acts in Mitosis to Regulate C-Myc Target Genes in Mammalian Tumor Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com