Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDKN3 (Human) Recombinant Protein (P01)

  • Catalog # : H00001033-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CDKN3 full-length ORF ( AAH64965, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MKPPSSIQTSCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.44
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001033-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1033
  • Gene Name:
  • CDKN3
  • Gene Alias:
  • CDI1,CIP2,FLJ25787,KAP,KAP1,MGC70625
  • Gene Description:
  • cyclin-dependent kinase inhibitor 3
  • Gene Summary:
  • The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • CDK2-associated dual specificity phosphatase,Cdk-associated protein phosphatase,cyclin-dependent kinase interacting protein 2,cyclin-dependent kinase interactor 1,kinase-associated phosphatase
  • RSS
  • YouTube
  • Linkedin
  • Facebook