Product Browser

Last updated: 2017/2/26
  • Related Product Showcase
  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDKN3 polyclonal antibody (A01)

  • Catalog # : H00001033-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CDKN3.
  • Immunogen:
  • CDKN3 (NP_005183, 51 a.a. ~ 140 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • CKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001033-A01
    Western Blot detection against Immunogen (36.01 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1033
  • Gene Name:
  • CDKN3
  • Gene Alias:
  • CDI1,CIP2,FLJ25787,KAP,KAP1,MGC70625
  • Gene Description:
  • cyclin-dependent kinase inhibitor 3
  • Gene Summary:
  • The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • CDK2-associated dual specificity phosphatase,Cdk-associated protein phosphatase,cyclin-dependent kinase interacting protein 2,cyclin-dependent kinase interactor 1,kinase-associated phosphatase
  • RSS
  • YouTube
  • Linkedin
  • Facebook