Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDKN2D (Human) Recombinant Protein (P01)

  • Catalog # : H00001032-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CDKN2D full-length ORF ( AAH01822, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGVSPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001032-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1032
  • Gene Name:
  • CDKN2D
  • Gene Alias:
  • INK4D,p19,p19-INK4D
  • Gene Description:
  • cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
  • Gene Summary:
  • The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq
  • Other Designations:
  • CDK inhibitor p19INK4d,cell cycle inhibitor, Nur77 associating protein,cyclin-dependent kinase 4 inhibitor D p19,cyclin-dependent kinase inhibitor 2D,inhibitor of cyclin-dependent kinase 4d
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook