CDKN2D MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CDKN2D protein.
Immunogen
CDKN2D (NP_001791, 1 a.a. ~ 166 a.a) full-length human protein.
Sequence
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CDKN2D expression in transfected 293T cell line (H00001032-T03) by CDKN2D MaxPab polyclonal antibody.
Lane 1: CDKN2D transfected lysate(18.26 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CDKN2D
Entrez GeneID
1032GeneBank Accession#
NM_001800Protein Accession#
NP_001791Gene Name
CDKN2D
Gene Alias
INK4D, p19, p19-INK4D
Gene Description
cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Omim ID
600927Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq
Other Designations
CDK inhibitor p19INK4d|cell cycle inhibitor, Nur77 associating protein|cyclin-dependent kinase 4 inhibitor D p19|cyclin-dependent kinase inhibitor 2D|inhibitor of cyclin-dependent kinase 4d
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com