Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDKN2C (Human) Recombinant Protein (P01)

  • Catalog # : H00001031-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CDKN2C full-length ORF ( AAH16173, 1 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHMASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.22
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001031-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1031
  • Gene Name:
  • CDKN2C
  • Gene Alias:
  • INK4C,p18,p18-INK4C
  • Gene Description:
  • cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)
  • Gene Summary:
  • The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq
  • Other Designations:
  • CDK6 inhibitor p18,OTTHUMP00000009730,OTTHUMP00000009731,OTTHUMP00000046546,cyclin-dependent inhibitor,cyclin-dependent kinase 4 inhibitor C,cyclin-dependent kinase 6 inhibitor p18,cyclin-dependent kinase inhibitor 2C
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook