Product Browser

Last updated: 2017/12/10
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDKN1C polyclonal antibody (A01)

  • Catalog # : H00001028-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CDKN1C.
  • Immunogen:
  • CDKN1C (NP_000067, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001028-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1028
  • Gene Name:
  • CDKN1C
  • Gene Alias:
  • BWCR,BWS,KIP2,WBS,p57
  • Gene Description:
  • cyclin-dependent kinase inhibitor 1C (p57, Kip2)
  • Gene Summary:
  • The protein encoded by this gene is a tight-binding, strong inhibitor of several G1 cyclin/Cdk complexes and a negative regulator of cell proliferation. Mutations in this gene are implicated in sporadic cancers and Beckwith-Wiedemann syndorome, suggesting that this gene is a tumor suppressor candidate. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000011736,cyclin-dependent kinase inhibitor 1C
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook