CDK8 monoclonal antibody (M01), clone 6H5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDK8.
Immunogen
CDK8 (NP_001251, 375 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CDK8 monoclonal antibody (M01), clone 6H5. Western Blot analysis of CDK8 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
CDK8 monoclonal antibody (M01), clone 6H5. Western Blot analysis of CDK8 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
CDK8 monoclonal antibody (M01), clone 6H5 Western Blot analysis of CDK8 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
CDK8 monoclonal antibody (M01), clone 6H5. Western Blot analysis of CDK8 expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
CDK8 monoclonal antibody (M01), clone 6H5. Western Blot analysis of CDK8 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDK8 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — CDK8
Entrez GeneID
1024GeneBank Accession#
NM_001260Protein Accession#
NP_001251Gene Name
CDK8
Gene Alias
K35, MGC126074, MGC126075
Gene Description
cyclin-dependent kinase 8
Omim ID
603184Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase and its regulatory subunit cyclin C are components of the RNA polymerase II holoenzyme complex, which phosphorylates the carboxy-terminal domain (CTD) of the largest subunit of RNA polymerase II. This kinase has also been shown to regulate transcription by targeting the CDK7/cyclin H subunits of the general transcription initiation factor IIH (TFIIH), thus providing a link between the 'Mediator-like' protein complexes and the basal transcription machinery. [provided by RefSeq
Other Designations
CDK8 protein kinase|OTTHUMP00000018158|cell division protein kinase 8|protein kinase K35
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com