CDK6 monoclonal antibody (M01J), clone 8H4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CDK6 monoclonal antibody (M01J), clone 8H4. Western Blot analysis of CDK6 expression in PC-12.
Western Blot (Cell lysate)
CDK6 monoclonal antibody (M01J), clone 8H4. Western Blot analysis of CDK6 expression in Jurkat.
Western Blot (Transfected lysate)
Western Blot analysis of CDK6 expression in transfected 293T cell line by CDK6 monoclonal antibody (M01J), clone 8H4.
Lane 1: CDK6 transfected lysate (Predicted MW: 35.86 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CDK6 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDK6 is 0.3 ng/ml as a capture antibody.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CDK2 and CDK6. HeLa cells were stained with anti-CDK2 rabbit purified polyclonal 1:1200 and anti-CDK6 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Immunofluorescence
Immunofluorescence of monoclonal antibody to CDK6 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.41 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDK6.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
CDK6 (NP_001250.1, 3 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFE
Host
Mouse
Reactivity
Human, Rat
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CDK6 monoclonal antibody (M01J), clone 8H4. Western Blot analysis of CDK6 expression in PC-12.Western Blot (Cell lysate)
CDK6 monoclonal antibody (M01J), clone 8H4. Western Blot analysis of CDK6 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of CDK6 expression in transfected 293T cell line by CDK6 monoclonal antibody (M01J), clone 8H4.
Lane 1: CDK6 transfected lysate (Predicted MW: 35.86 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CDK6 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDK6 is 0.3 ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CDK2 and CDK6. HeLa cells were stained with anti-CDK2 rabbit purified polyclonal 1:1200 and anti-CDK6 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to CDK6 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — CDK6
Entrez GeneID
1021GeneBank Accession#
NM_001259.1Protein Accession#
NP_001250.1Gene Name
CDK6
Gene Alias
MGC59692, PLSTIRE, STQTL11
Gene Description
cyclin-dependent kinase 6
Omim ID
603368Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb. [provided by RefSeq
Other Designations
cell division protein kinase 6
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com