CDK3 monoclonal antibody (M01), clone 3C12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDK3.
Immunogen
CDK3 (NP_001249, 206 a.a. ~ 305 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRFRH
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CDK3 expression in transfected 293T cell line by CDK3 monoclonal antibody (M01), clone 3C12.
Lane 1: CDK3 transfected lysate(35 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CDK3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDK3 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — CDK3
Entrez GeneID
1018GeneBank Accession#
NM_001258Protein Accession#
NP_001249Gene Name
CDK3
Gene Alias
-
Gene Description
cyclin-dependent kinase 3
Omim ID
123828Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cyclin-dependent protein kinase family. The protein promotes entry into S phase, in part by activating members of the E2F family of transcription factors. The protein also associates with cyclin C and phosphorylates the retinoblastoma 1 protein to promote exit from G0. [provided by RefSeq
Other Designations
-
-
Interactome
-
Publication Reference
-
HuR promotes breast cancer cell proliferation and survival via binding to CDK3 mRNA.
Zhang Z, Huang A, Zhang A, Zhou C.
Biomedicine & Pharmacotherapy 2017 May; 91:788.
Application:WB-Ti, Human, MDA-MB-231, MCF-7cells.
-
HuR promotes breast cancer cell proliferation and survival via binding to CDK3 mRNA.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com