Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDK2 monoclonal antibody (M02), clone 2E8

  • Catalog # : H00001017-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant CDK2.
  • Immunogen:
  • CDK2 (AAH03065, 211 a.a. ~ 298 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • QLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001017-M02
    Western Blot detection against Immunogen (35.42 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CDK2 monoclonal antibody (M02), clone 2E8 Western Blot analysis of CDK2 expression in HL-60 ( Cat # L014V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CDK2 monoclonal antibody (M02), clone 2E8. Western Blot analysis of CDK2 expression in Jurkat ( Cat # L017V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CDK2 expression in transfected 293T cell line by CDK2 monoclonal antibody (M02), clone 2E8.

    Lane 1: CDK2 transfected lysate(33.9 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged CDK2 is approximately 0.03ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of CDK2 over-expressed 293 cell line, cotransfected with CDK2 Validated Chimera RNAi ( Cat # H00001017-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CDK2 monoclonal antibody (M02) clone 2E8 (Cat # H00001017-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1017
  • Gene Name:
  • CDK2
  • Gene Alias:
  • p33(CDK2)
  • Gene Description:
  • cyclin-dependent kinase 2
  • Gene Summary:
  • The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein kinase is highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2. It is a catalytic subunit of the cyclin-dependent protein kinase complex, whose activity is restricted to the G1-S phase, and essential for cell cycle G1/S phase transition. This protein associates with and regulated by the regulatory subunits of the complex including cyclin A or E, CDK inhibitor p21Cip1 (CDKN1A) and p27Kip1 (CDKN1B). Its activity is also regulated by its protein phosphorylation. Two alternatively spliced variants and multiple transcription initiation sites of this gene have been reported. [provided by RefSeq
  • Other Designations:
  • cdc2-related protein kinase,cell devision kinase 2,p33 protein kinase
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook