CDH17 monoclonal antibody (M03), clone 3H2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDH17.
Immunogen
CDH17 (NP_004054, 24 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIEVKDINDNRPTFLQSKY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (83)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CDH17 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDH17 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — CDH17
Entrez GeneID
1015GeneBank Accession#
NM_004063Protein Accession#
NP_004054Gene Name
CDH17
Gene Alias
CDH16, FLJ26931, HPT-1, HPT1, MGC138218, MGC142024
Gene Description
cadherin 17, LI cadherin (liver-intestine)
Omim ID
603017Gene Ontology
HyperlinkGene Summary
This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
HPT-1 cadherin|LI cadherin|cadherin 17|cadherin-16|human intestinal peptide-associated transporter HPT-1|human peptide transporter 1|liver-intestine cadherin
-
Interactome
-
Disease
-
Publication Reference
-
The contribution of cell phenotype to the behavior of gastric cancer.
Solcia E, Klersy C, Vanoli A, Grillo F, Manca R, Tava F, Luinetti O, Fiocca R.
Gastric Cancer 2013 Jan; 16(4):462.
Application:IHC-P, Human, Human gastric cancer.
-
The contribution of cell phenotype to the behavior of gastric cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com