Product Browser

Last updated: 2017/12/10
  • Related Product Showcase
  • By Disease

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDH17 polyclonal antibody (A01)

  • Catalog # : H00001015-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CDH17.
  • Immunogen:
  • CDH17 (NP_004054, 24 a.a. ~ 131 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIEVKDINDNRPTFLQSKY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001015-A01
    Western Blot detection against Immunogen (37.99 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1015
  • Gene Name:
  • CDH17
  • Gene Alias:
  • CDH16,FLJ26931,HPT-1,HPT1,MGC138218,MGC142024
  • Gene Description:
  • cadherin 17, LI cadherin (liver-intestine)
  • Gene Summary:
  • This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • HPT-1 cadherin,LI cadherin,cadherin 17,cadherin-16,human intestinal peptide-associated transporter HPT-1,human peptide transporter 1,liver-intestine cadherin
  • RSS
  • YouTube
  • Linkedin
  • Facebook