CDH6 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CDH6 partial ORF ( NP_004923, 513 a.a. - 612 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
DKDDPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHEMSTYLLPVVISDNDYPVQSSTGTVTVRVCACDHHGNMQSCHAEALIHPTGLS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CDH6
Entrez GeneID
1004GeneBank Accession#
NM_004932Protein Accession#
NP_004923Gene Name
CDH6
Gene Alias
KCAD
Gene Description
cadherin 6, type 2, K-cadherin (fetal kidney)
Omim ID
603007Gene Ontology
HyperlinkGene Summary
This gene encodes a type II classical cadherin from the cadherin superfamily. The encoded membrane protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Cadherins mediate cell-cell binding in a homophilic manner, contributing to the sorting of heterogeneous cell types and the maintenance of orderly structures such as epithelium. Strong transcriptional expression of this gene has been observed in hepatocellular and renal carcinoma cell lines, suggesting a possible role in metastasis and invasion. [provided by RefSeq
Other Designations
K-cadherin|cadherin 6, K-cadherin (fetal kidney)|cadherin 6, type 2|cadherin, fetal kidney|kidney cadherin
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com