CDH6 monoclonal antibody (M05), clone 2F2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CDH6 expression in transfected 293T cell line by CDH6 monoclonal antibody (M05), clone 2F2.
Lane 1: CDH6 transfected lysate(73.9 KDa).
Lane 2: Non-transfected lysate.
RNAi Knockdown (Antibody validated)
Western blot analysis of CDH6 over-expressed 293 cell line, cotransfected with CDH6 Validated Chimera RNAi ( Cat # H00001004-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CDH6 monoclonal antibody (M05), clone 2F2 (Cat # H00001004-M05 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDH6.
Immunogen
CDH6 (NP_004923, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DKDDPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHEMSTYLLPVVISDNDYPVQSSTGTVTVRVCACDHHGNMQSCHAEALIHPTGLS
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CDH6 expression in transfected 293T cell line by CDH6 monoclonal antibody (M05), clone 2F2.
Lane 1: CDH6 transfected lysate(73.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of CDH6 over-expressed 293 cell line, cotransfected with CDH6 Validated Chimera RNAi ( Cat # H00001004-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CDH6 monoclonal antibody (M05), clone 2F2 (Cat # H00001004-M05 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — CDH6
Entrez GeneID
1004GeneBank Accession#
NM_004932Protein Accession#
NP_004923Gene Name
CDH6
Gene Alias
KCAD
Gene Description
cadherin 6, type 2, K-cadherin (fetal kidney)
Omim ID
603007Gene Ontology
HyperlinkGene Summary
This gene encodes a type II classical cadherin from the cadherin superfamily. The encoded membrane protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Cadherins mediate cell-cell binding in a homophilic manner, contributing to the sorting of heterogeneous cell types and the maintenance of orderly structures such as epithelium. Strong transcriptional expression of this gene has been observed in hepatocellular and renal carcinoma cell lines, suggesting a possible role in metastasis and invasion. [provided by RefSeq
Other Designations
K-cadherin|cadherin 6, K-cadherin (fetal kidney)|cadherin 6, type 2|cadherin, fetal kidney|kidney cadherin
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com