CDC42 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CDC42 full-length ORF ( AAH02711, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
46.75
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CDC42
Entrez GeneID
998GeneBank Accession#
BC002711Protein Accession#
AAH02711Gene Name
CDC42
Gene Alias
CDC42Hs, G25K
Gene Description
cell division cycle 42 (GTP binding protein, 25kDa)
Omim ID
116952Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq
Other Designations
GTP-binding protein, 25kD|OTTHUMP00000002834|OTTHUMP00000002926|cell division cycle 42|cell division cycle 42 (GTP binding protein, 25kD)|cell division cycle 42 (GTP-binding protein, 25kD)|dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD))|d
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Hepatitis B virus utilizes a retrograde trafficking route via the trans-Golgi network to avoid lysosomal degradation.
Ying-Yi Li, Kazuyuki Kuroki, Tetsuro Shimakami, Kazuhisa Murai, Kazunori Kawaguchi, Takayoshi Shirasaki, Kouki Nio, Saiho Sugimoto, Tomoki Nishikawa, Hikari Okada, Noriaki Orita, Hideo Takayama, Ying Wang, Phuong Doan Thi Bich, Astuya Ishida, Sadahiro Iwabuchi, Shinichi Hashimoto, Takeshi Shimaoka, Noriko Tabata, Miho Watanabe-Takahashi, Kiyotaka Nishikawa, Hiroshi Yanagawa, Motoharu Seiki, Kouji Matsushima, Taro Yamashita, Shuichi Kaneko, Masao Honda.
Cellular and Molecular Gastroenterology and Hepatology 2022 Oct; S2352-345X(22):219.
Application:Func, Recombinant proteins.
-
Hepatitis B virus utilizes a retrograde trafficking route via the trans-Golgi network to avoid lysosomal degradation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com