Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDC42 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00000998-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human CDC42 protein.
  • Immunogen:
  • CDC42 (NP_001782.1, 1 a.a. ~ 191 a.a) full-length human protein.
  • Sequence:
  • MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CDC42 expression in transfected 293T cell line (H00000998-T02) by CDC42 MaxPab polyclonal antibody.

    Lane 1: CDC42 transfected lysate(21.30 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • Proximity Ligation Analysis of protein-protein interactions between CDC42 and MAPK8. HeLa cells were stained with anti-CDC42 rabbit purified polyclonal 1:1200 and anti-MAPK8 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 998
  • Gene Name:
  • CDC42
  • Gene Alias:
  • CDC42Hs,G25K
  • Gene Description:
  • cell division cycle 42 (GTP binding protein, 25kDa)
  • Gene Summary:
  • The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • GTP-binding protein, 25kD,OTTHUMP00000002834,OTTHUMP00000002926,cell division cycle 42,cell division cycle 42 (GTP binding protein, 25kD),cell division cycle 42 (GTP-binding protein, 25kD),dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD)),d
  • RSS
  • YouTube
  • Linkedin
  • Facebook