CDC25C monoclonal antibody (M01), clone 3B11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDC25C.
Immunogen
CDC25C (AAH19089, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCST
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CDC25C monoclonal antibody (M01), clone 3B11 Western Blot analysis of CDC25C expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CDC25C expression in transfected 293T cell line by CDC25C monoclonal antibody (M01), clone 3B11.
Lane 1: CDC25C transfected lysate(53.312 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CDC25C on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 6 ug/ml]Immunoprecipitation
Immunoprecipitation of CDC25C transfected lysate using anti-CDC25C monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CDC25C MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDC25C is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of CDC25C over-expressed 293 cell line, cotransfected with CDC25C Validated Chimera RNAi ( Cat # H00000995-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CDC25C monoclonal antibody (M01), clone 3B11 (Cat # H00000995-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — CDC25C
Entrez GeneID
995GeneBank Accession#
BC019089Protein Accession#
AAH19089Gene Name
CDC25C
Gene Alias
CDC25
Gene Description
cell division cycle 25 homolog C (S. pombe)
Omim ID
157680Gene Ontology
HyperlinkGene Summary
This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known. [provided by RefSeq
Other Designations
cell division cycle 25C|cell division cycle 25C protein|dual specificity phosphatase CDC25C|m-phase inducer phosphatase 3|mitosis inducer CDC25|phosphotyrosine phosphatase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com