Product Browser

Last updated: 2017/2/19
  • Related Product Showcase
  • By Research Area

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDC25C polyclonal antibody (A01)

  • Catalog # : H00000995-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CDC25C.
  • Immunogen:
  • CDC25C (AAH19089, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • FRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCST
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 995
  • Gene Name:
  • CDC25C
  • Gene Alias:
  • CDC25
  • Gene Description:
  • cell division cycle 25 homolog C (S. pombe)
  • Gene Summary:
  • This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known. [provided by RefSeq
  • Other Designations:
  • cell division cycle 25C,cell division cycle 25C protein,dual specificity phosphatase CDC25C,m-phase inducer phosphatase 3,mitosis inducer CDC25,phosphotyrosine phosphatase
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook