Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDC20 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00000991-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human CDC20 protein.
  • Immunogen:
  • CDC20 (AAH00624.1, 1 a.a. ~ 499 a.a) full-length human protein.
  • Sequence:
  • MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWVLNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CDC20 expression in transfected 293T cell line (H00000991-T02) by CDC20 MaxPab polyclonal antibody.

    Lane 1: CDC20 transfected lysate(54.80 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • Proximity Ligation Analysis of protein-protein interactions between CDC20 and ANAPC11. HeLa cells were stained with anti-CDC20 rabbit purified polyclonal 1:1200 and anti-ANAPC11 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 991
  • Gene Name:
  • CDC20
  • Gene Alias:
  • CDC20A,MGC102824,bA276H19.3,p55CDC
  • Gene Description:
  • cell division cycle 20 homolog (S. cerevisiae)
  • Gene Summary:
  • CDC20 appears to act as a regulatory protein interacting with several other proteins at multiple points in the cell cycle. It is required for two microtubule-dependent processes, nuclear movement prior to anaphase and chromosome separation. [provided by RefSeq
  • Other Designations:
  • CDC20 cell division cycle 20 homolog,OTTHUMP00000008571,OTTHUMP00000008572,cell division cycle 20
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook