SEPT7 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SEPT7 partial ORF ( AAH25987, 331 a.a. - 433 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
PLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQNSSRTLEKNKKKGKIF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.96
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SEPT7
Entrez GeneID
989GeneBank Accession#
BC025987Protein Accession#
AAH25987Gene Name
SEPT7
Gene Alias
CDC10, CDC3, Nbla02942, SEPT7A
Gene Description
septin 7
Omim ID
603151Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is highly similar to the CDC10 protein of Saccharomyces cerevisiae. The protein also shares similarity with Diff 6 of Drosophila and with H5 of mouse. Each of these similar proteins, including the yeast CDC10, contains a GTP-binding motif. The yeast CDC10 protein is a structural component of the 10 nm filament which lies inside the cytoplasmic membrane and is essential for cytokinesis. Although the exact function of this gene has not yet been determined, its high similarity to yeast CDC10 and the high conservative nature of eukaryotic cell cycle machinery suggest a similar role to that of its yeast counterpart. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
CDC10 (cell division cycle 10, S. cerevisiae, homolog)|CDC10 cell division cycle 10 homolog|cell division cycle 10
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com