CDC5L (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CDC5L partial ORF ( NP_001244, 719 a.a. - 802 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
ILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.98
Interspecies Antigen Sequence
Mouse (95); Rat (94)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CDC5L
Entrez GeneID
988GeneBank Accession#
NM_001253Protein Accession#
NP_001244Gene Name
CDC5L
Gene Alias
CEF1, KIAA0432, PCDC5RP, dJ319D22.1, hCDC5
Gene Description
CDC5 cell division cycle 5-like (S. pombe)
Omim ID
602868Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene shares a significant similarity with Schizosaccharomyces pombe cdc5 gene product, which is a cell cycle regulator important for G2/M transition. This protein has been demonstrated to act as a positive regulator of cell cycle G2/M progression. It was also found to be an essential component of a non-snRNA spliceosome, which contains at least five additional protein factors and is required for the second catalytic step of pre-mRNA splicing. [provided by RefSeq
Other Designations
CDC5 (cell division cycle 5, S. pombe, homolog)-like|CDC5-like|Cdc5-related protein|Cell division cycle 5, S. pombe, homolog-like|OTTHUMP00000016529|dJ319D22.1 (CDC5-like protein)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com