CDC5L monoclonal antibody (M08), clone 3C12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDC5L.
Immunogen
CDC5L (NP_001244, 719 a.a. ~ 802 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (94)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.98 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CDC5L expression in transfected 293T cell line by CDC5L monoclonal antibody (M08), clone 3C12.
Lane 1: CDC5L transfected lysate(92.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDC5L is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — CDC5L
Entrez GeneID
988GeneBank Accession#
NM_001253Protein Accession#
NP_001244Gene Name
CDC5L
Gene Alias
CEF1, KIAA0432, PCDC5RP, dJ319D22.1, hCDC5
Gene Description
CDC5 cell division cycle 5-like (S. pombe)
Omim ID
602868Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene shares a significant similarity with Schizosaccharomyces pombe cdc5 gene product, which is a cell cycle regulator important for G2/M transition. This protein has been demonstrated to act as a positive regulator of cell cycle G2/M progression. It was also found to be an essential component of a non-snRNA spliceosome, which contains at least five additional protein factors and is required for the second catalytic step of pre-mRNA splicing. [provided by RefSeq
Other Designations
CDC5 (cell division cycle 5, S. pombe, homolog)-like|CDC5-like|Cdc5-related protein|Cell division cycle 5, S. pombe, homolog-like|OTTHUMP00000016529|dJ319D22.1 (CDC5-like protein)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com