Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDC2L1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00000984-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CDC2L1 partial ORF ( NP_001778, 686 a.a. - 795 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KRFGALLSDQGFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000984-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 984
  • Gene Name:
  • CDC2L1
  • Gene Alias:
  • CDC2L2,CDK11,CDK11-p110,CDK11-p46,CDK11-p58,CLK-1,FLJ59152,PK58,p58,p58CDC2L1,p58CLK-1
  • Gene Description:
  • cell division cycle 2-like 1 (PITSLRE proteins)
  • Gene Summary:
  • This gene encodes a member of the p34Cdc2 protein kinase family. p34Cdc2 kinase family members are known to be essential for eukaryotic cell cycle control. This gene is in close proximity to CDC2L2, a nearly identical gene in the same chromosomal region. The gene loci including this gene, CDC2L2, as well as metalloprotease MMP21/22, consist of two identical, tandemly linked genomic regions which are thought to be a part of the larger region that has been duplicated. This gene and CDC2L2 were shown to be deleted or altered frequently in neuroblastoma with amplified MYCN genes. The protein kinase encoded by this gene could be cleaved by caspases and was demonstrated to play roles in cell apoptosis. Several alternatively spliced variants of this gene have been reported. [provided by RefSeq
  • Other Designations:
  • CDC-related protein kinase p58,OTTHUMP00000000760,OTTHUMP00000000767,OTTHUMP00000000768,PITSLRE serine/threonine-protein kinase CDC2L1,PITSLREA,cell division cycle 2-like 2 (PITSLRE proteins),cell division cycle 2-like protein kinase 1,galactosyltransfera
  • RSS
  • YouTube
  • Linkedin
  • Facebook