CDC2L1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CDC2L1 partial ORF ( NP_001778, 686 a.a. - 795 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
KRFGALLSDQGFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CDC2L1
Entrez GeneID
984GeneBank Accession#
NM_001787Protein Accession#
NP_001778Gene Name
CDC2L1
Gene Alias
CDC2L2, CDK11, CDK11-p110, CDK11-p46, CDK11-p58, CLK-1, FLJ59152, PK58, p58, p58CDC2L1, p58CLK-1
Gene Description
cell division cycle 2-like 1 (PITSLRE proteins)
Omim ID
176873Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the p34Cdc2 protein kinase family. p34Cdc2 kinase family members are known to be essential for eukaryotic cell cycle control. This gene is in close proximity to CDC2L2, a nearly identical gene in the same chromosomal region. The gene loci including this gene, CDC2L2, as well as metalloprotease MMP21/22, consist of two identical, tandemly linked genomic regions which are thought to be a part of the larger region that has been duplicated. This gene and CDC2L2 were shown to be deleted or altered frequently in neuroblastoma with amplified MYCN genes. The protein kinase encoded by this gene could be cleaved by caspases and was demonstrated to play roles in cell apoptosis. Several alternatively spliced variants of this gene have been reported. [provided by RefSeq
Other Designations
CDC-related protein kinase p58|OTTHUMP00000000760|OTTHUMP00000000767|OTTHUMP00000000768|PITSLRE serine/threonine-protein kinase CDC2L1|PITSLREA|cell division cycle 2-like 2 (PITSLRE proteins)|cell division cycle 2-like protein kinase 1|galactosyltransfera
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com