CD81 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CD81 partial ORF ( AAH02978, 25 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
GGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFY
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.96
Interspecies Antigen Sequence
Mouse (98)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CD81
Entrez GeneID
975GeneBank Accession#
BC002978Protein Accession#
AAH02978Gene Name
CD81
Gene Alias
S5.7, TAPA1, TSPAN28
Gene Description
CD81 molecule
Omim ID
186845Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. [provided by RefSeq
Other Designations
26 kDa cell surface protein TAPA-1|CD81 antigen|CD81 antigen (target of antiproliferative antibody 1)|target of antiproliferative antibody 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Tetraspanins displayed in retrovirus-derived virus-like particles and their immunogenicity.
Soares HR, Castro R, Tomás HA, Rodrigues AF, Gomes-Alves P, Bellier B, Klatzmann D, Carrondo M, Alves PM, Coroadinha AS.
Vaccine 2016 Mar; 34(13):1634.
Application:ELISPOT, Mouse, Serum.
-
Tetraspanins displayed in retrovirus-derived virus-like particles and their immunogenicity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com