Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD81 (Human) Recombinant Protein (Q01)

  • Catalog # : H00000975-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CD81 partial ORF ( AAH02978, 25 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFY
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.96
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000975-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 975
  • Gene Name:
  • CD81
  • Gene Alias:
  • S5.7,TAPA1,TSPAN28
  • Gene Description:
  • CD81 molecule
  • Gene Summary:
  • The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. [provided by RefSeq
  • Other Designations:
  • 26 kDa cell surface protein TAPA-1,CD81 antigen,CD81 antigen (target of antiproliferative antibody 1),target of antiproliferative antibody 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook