CD59 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CD59 full-length ORF ( NP_000602.1, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
40.6
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CD59
Entrez GeneID
966GeneBank Accession#
NM_000611.4Protein Accession#
NP_000602.1Gene Name
CD59
Gene Alias
16.3A5, 1F5, EJ16, EJ30, EL32, FLJ38134, FLJ92039, G344, HRF-20, HRF20, MAC-IP, MACIF, MEM43, MGC2354, MIC11, MIN1, MIN2, MIN3, MIRL, MSK21, p18-20
Gene Description
CD59 molecule, complement regulatory protein
Omim ID
107271Gene Ontology
HyperlinkGene Summary
This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq
Other Designations
20 kDa homologous restriction factor|CD59 antigen|CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344)|CD59 glycoprotein|Ly-6-like protein|T cell-activating protein|human leukocyte antigen MIC11|lymphocytic a
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com