Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD59 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00000966-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human CD59 protein.
  • Immunogen:
  • CD59 (NP_000602.1, 1 a.a. ~ 128 a.a) full-length human protein.
  • Sequence:
  • MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CD59 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD59 expression in A-431.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CD59 expression in transfected 293T cell line (H00000966-T03) by CD59 MaxPab polyclonal antibody.

    Lane 1: CD59 transfected lysate(14.20 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 966
  • Gene Name:
  • CD59
  • Gene Alias:
  • 16.3A5,1F5,EJ16,EJ30,EL32,FLJ38134,FLJ92039,G344,HRF-20,HRF20,MAC-IP,MACIF,MEM43,MGC2354,MIC11,MIN1,MIN2,MIN3,MIRL,MSK21,p18-20
  • Gene Description:
  • CD59 molecule, complement regulatory protein
  • Gene Summary:
  • This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • 20 kDa homologous restriction factor,CD59 antigen,CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344),CD59 glycoprotein,Ly-6-like protein,T cell-activating protein,human leukocyte antigen MIC11,lymphocytic a
  • RSS
  • YouTube
  • Linkedin
  • Facebook