Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD48 polyclonal antibody (A01)

  • Catalog # : H00000962-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant CD48.
  • Immunogen:
  • CD48 (AAH30224, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLGESGEPKSKSPLQWPQMDHCRASWEAWGTLGEEERKTSGQV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 962
  • Gene Name:
  • CD48
  • Gene Alias:
  • BCM1,BLAST,BLAST1,MEM-102,SLAMF2,hCD48,mCD48
  • Gene Description:
  • CD48 molecule
  • Gene Summary:
  • BLAST1 is the designation used for an activation-associated cell surface glycoprotein of 40 to 45 kD expressed primarily in mitogen-stimulated human lymphocytes. The protein sequence predicted by the cDNA encoding BLAST1 indicates that BLAST1 is a member of the immunoglobulin supergene family. Yokoyama (1991) identified the BLAST1 activation/adhesion molecule as CD48.[supplied by OMIM
  • Other Designations:
  • CD48 antigen (B-cell membrane protein),OTTHUMP00000025680,OTTHUMP00000060268
  • RSS
  • YouTube
  • Linkedin
  • Facebook