Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD47 (Human) Recombinant ProteinHuPro Protein

  • Catalog # : H00000961-H01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified CD47 (NP_001768.1, 19 a.a. - 141 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293H cells
  • Sequence:
  • QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 16.61
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-CD47 plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • ≥ 10 ug/ml
  • Activity:
  • Not Tested
  • Quality Control Testing:
  • SDS-PAGE and Western Blot
    SDS-PAGE Gel
    QC Testing of H00000961-H01

    Western Blot
    QC Testing of H00000961-H01
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Entrez GeneID:
  • 961
  • Gene Name:
  • CD47
  • Gene Alias:
  • IAP,MER6,OA3
  • Gene Description:
  • CD47 molecule
  • Gene Summary:
  • This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Four alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • CD47 antigen,CD47 antigen (Rh-related antigen, integrin-associated signal transducer),CD47 glycoprotein,Rh-related antigen,antigen identified by monoclonal antibody 1D8,antigenic surface determinant protein OA3,integrin associated protein,integrin-associa
  • RSS
  • YouTube
  • Linkedin
  • Facebook