Product Browser

Last updated: 2017/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ENTPD5 (Human) Recombinant Protein (Q01)

  • Catalog # : H00000957-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ENTPD5 partial ORF ( NP_001240, 319 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • EEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.76
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000957-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 957
  • Gene Name:
  • ENTPD5
  • Gene Alias:
  • CD39L4,MGC163357,MGC163359,NTPDase-5,PCPH
  • Gene Description:
  • ectonucleoside triphosphate diphosphohydrolase 5
  • Gene Summary:
  • The protein encoded by this gene is similar to E-type nucleotidases (NTPases)/ecto-ATPase/apyrases. NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD5 contains 4 apyrase-conserved regions which is characteristic of NTPases. [provided by RefSeq
  • Other Designations:
  • CD39-like 4,Pcph proto-oncogene protein,proto-oncogene CPH
  • RSS
  • YouTube
  • Linkedin
  • Facebook