ENTPD3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
ENTPD3 MaxPab rabbit polyclonal antibody. Western Blot analysis of ENTPD3 expression in mouse testis.
Western Blot (Transfected lysate)
Western Blot analysis of ENTPD3 expression in transfected 293T cell line (H00000956-T01) by ENTPD3 MaxPab polyclonal antibody.
Lane 1: ENTPD3 transfected lysate(50.70 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ENTPD3 protein.
Immunogen
ENTPD3 (AAH29869.1, 1 a.a. ~ 452 a.a) full-length human protein.
Sequence
MFTVLTRQPCEQAGLKALYRTPTVIALVVLLVSIVVLVSITVIQIHKQEVLPPGLKYGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKNHLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFKACHDQETCSFDGVYQPKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCSQNWSQLPLLLPKFDEVYARSYCFSANYIYHLFVNGYKFTEETWPQIHFEKEE
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ENTPD3 MaxPab rabbit polyclonal antibody. Western Blot analysis of ENTPD3 expression in mouse testis.Western Blot (Transfected lysate)
Western Blot analysis of ENTPD3 expression in transfected 293T cell line (H00000956-T01) by ENTPD3 MaxPab polyclonal antibody.
Lane 1: ENTPD3 transfected lysate(50.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ENTPD3
Entrez GeneID
956GeneBank Accession#
BC029869.1Protein Accession#
AAH29869.1Gene Name
ENTPD3
Gene Alias
CD39L3, FLJ93839, HB6, NTPDase-3
Gene Description
ectonucleoside triphosphate diphosphohydrolase 3
Omim ID
603161Gene Ontology
HyperlinkGene Summary
ENTPD3 is similar to E-type nucleotidases (NTPases). NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD3 contains 4 apyrase-conserved regions which is characteristic of NTPases. [provided by RefSeq
Other Designations
CD39-like 3
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com