Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SIGLEC6 monoclonal antibody (M02), clone 2G6

  • Catalog # : H00000946-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SIGLEC6.
  • Immunogen:
  • SIGLEC6 (NP_001236, 371 a.a. ~ 453 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • KTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000946-M02
    Western Blot detection against Immunogen (34.87 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SIGLEC6 expression in transfected 293T cell line by SIGLEC6 monoclonal antibody (M02), clone 2G6.

    Lane 1: SIGLEC6 transfected lysate(48.3 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of SIGLEC6 transfected lysate using anti-SIGLEC6 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SIGLEC6 MaxPab rabbit polyclonal antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 946
  • Gene Name:
  • SIGLEC6
  • Gene Alias:
  • CD327,CD33L,CD33L1,CDw327,OBBP1,SIGLEC-6
  • Gene Description:
  • sialic acid binding Ig-like lectin 6
  • Other Designations:
  • CD33 antigen-like 1,CDw327 antigen,OTTHUMP00000164940,OTTHUMP00000164941,OTTHUMP00000164942,Obesity-binding protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook