Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF8 (Human) Recombinant Protein (Q01)

  • Catalog # : H00000943-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFRSF8 partial ORF ( NP_001234, 21 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.17
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000943-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 943
  • Gene Name:
  • TNFRSF8
  • Gene Alias:
  • CD30,D1S166E,KI-1
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 8
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • CD30 antigen,CD30L receptor,Ki-1 antigen,OTTHUMP00000001783,cytokine receptor CD30,lymphocyte activation antigen CD30
  • RSS
  • YouTube
  • Linkedin
  • Facebook